PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000303239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 446aa    MW: 50171.3 Da    PI: 7.6621
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000303239genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding408.9e-1356103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
    MDP0000303239  56 RGPWTIEEDHKLMNFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYL 103
                      89******************************99************97 PP

2Myb_DNA-binding47.34.9e-15109152146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T+ E+ + ++++  lG++ W++Ia++++ gRt++++k++w++
    MDP0000303239 109 RGGFTEAEENQMIQLHSCLGNR-WSKIASHFP-GRTDNEIKNHWNT 152
                      788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-2047106IPR009057Homeodomain-like
PROSITE profilePS5129413.51751103IPR017930Myb domain
SuperFamilySSF466891.69E-2753150IPR009057Homeodomain-like
SMARTSM007176.3E-655105IPR001005SANT/Myb domain
PfamPF002491.2E-1056103IPR001005SANT/Myb domain
CDDcd001671.14E-458103No hitNo description
PROSITE profilePS5129424.011104158IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-24107159IPR009057Homeodomain-like
SMARTSM007172.7E-13108156IPR001005SANT/Myb domain
PfamPF002492.5E-13109152IPR001005SANT/Myb domain
CDDcd001679.93E-10112152No hitNo description
PfamPF061557.1E-8320381IPR010376Domain of unknown function DUF971
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MDTTLVKRLC XIWGSSKLHA PLGPWHGNII NMSTCREIEF VTMGRLPCCD KVGLKRGPWT  60
IEEDHKLMNF ILNNGIHCWR MVPKLAGLLR CGKSCRLRWI NYLRPDLKRG GFTEAEENQM  120
IQLHSCLGNR WSKIASHFPG RTDNEIKNHW NTRIKKRLKH LGVDPLTHKP IEEKEHIEEN  180
KDTITQQSNI TSSSSEEGLE ESRGTGLEAK LLEDSNGNKG FPESDEKSQN EVQLTTLDDA  240
NDISENYEVF CGSLDLGTLM LNQGFPNTSS MSNSYSTSFS VEDSNNASIS IGETMQENCL  300
QHHNXEGELW RNKKFAHLYR KVXVEFGNGN VFNLSAEFLR IHSPAVDAKI RSIAGEKVIS  360
GRRHVGIMSA EPVGNYGVSL SVTGAWPDNM GHGLVSSSLR RPKGLQRSCI ERHCHLLFVC  420
LHCNLMQLLC TCKLVGHYTS NLCANV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27541585108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.41751e-114fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008357861.10.0PREDICTED: myb-related protein 315-like
TrEMBLM5WZ011e-133M5WZ01_PRUPE; Uncharacterized protein
STRINGGLYMA16G06900.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66253150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-79myb domain protein 40